(data stored in ACNUC7421 zone)

EMBL: CP000283.PE466

CP000283.PE466       Location/Qualifiers
FT   CDS             complement(539674..541113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37706"
FT                   /db_xref="GOA:Q13DY3"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DY3"
FT                   /protein_id="ABE37706.1"
FT                   /translation="MVKNRPGHENTQHEKDPRENAASVGASDAHPEQAAEVDVDAPIEA
FT                   LALNPVEPTAEELRDDPALELSAEHRQQDVIDAEPLPETATDDPPETRFASTSDKAEEA
FT                   AARSAAAAEPRRPGIVAAMLPPVLAVAIAAAVVVGAAKTGLLPQFLSSTSVSAPEGDVA
FT                   AIDALKARIADLEARPTPTGSNTAAATPAAAADPALAGKVDALEKTVAALRDDLATLRD
FT                   RSEQLASALKEVKAAPSEPTATASEPPAMASTDKTPPDKAAADKAATDSAAALAAINAR
FT                   LTELEHAAKTATEAAPQAPQPAVVSDDAPLRRLVTATMLDLTVKQGAPYAAILKAAEPL
FT                   ATETGALKPLEPFAATGVPAAAALGRELIALLPKLLSGAEGASNANFIDRFQSNAERLI
FT                   RIQRSDATAGIDRTAIVGRITAAAQRGDLAEARRELKALAPADRAPVQSWIDKSEARDQ
FT                   ALAASHSFATAALAALQKPSP"
     MVKNRPGHEN TQHEKDPREN AASVGASDAH PEQAAEVDVD APIEALALNP VEPTAEELRD        60
     DPALELSAEH RQQDVIDAEP LPETATDDPP ETRFASTSDK AEEAAARSAA AAEPRRPGIV       120
     AAMLPPVLAV AIAAAVVVGA AKTGLLPQFL SSTSVSAPEG DVAAIDALKA RIADLEARPT       180
     PTGSNTAAAT PAAAADPALA GKVDALEKTV AALRDDLATL RDRSEQLASA LKEVKAAPSE       240
     PTATASEPPA MASTDKTPPD KAAADKAATD SAAALAAINA RLTELEHAAK TATEAAPQAP       300
     QPAVVSDDAP LRRLVTATML DLTVKQGAPY AAILKAAEPL ATETGALKPL EPFAATGVPA       360
     AAALGRELIA LLPKLLSGAE GASNANFIDR FQSNAERLIR IQRSDATAGI DRTAIVGRIT       420
     AAAQRGDLAE ARRELKALAP ADRAPVQSWI DKSEARDQAL AASHSFATAA LAALQKPSP        479
//

If you have problems or comments...

PBIL Back to PBIL home page