(data stored in ACNUC7421 zone)

EMBL: CP000283.PE470

CP000283.PE470       Location/Qualifiers
FT   CDS             544215..544628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0472"
FT                   /product="protein of unknown function DUF589"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37710"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX9"
FT                   /protein_id="ABE37710.1"
FT                   /translation="MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKK
FT                   GDRAFFYHSNEGKEIIGIAEIIREAYPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAE
FT                   PRLAEMALLKYSRLSVQPVTADEWKLICKMGGL"
     MAYWLVKSEP SVWSWDQQVA KGAKGEAWTG VRNHSAKLHM IAMKKGDRAF FYHSNEGKEI        60
     IGIAEIIREA YPDPTDESGK FVCVDLKADK KLKTPVTLVA VKAEPRLAEM ALLKYSRLSV       120
     QPVTADEWKL ICKMGGL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page