(data stored in ACNUC7421 zone)

EMBL: CP000283.PE477

CP000283.PE477       Location/Qualifiers
FT   CDS             complement(553099..554922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0479"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37717"
FT                   /db_xref="GOA:Q13DX2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX2"
FT                   /protein_id="ABE37717.1"
FT                   /translation="MAANGNGAPAVNGHAYPIEDHVYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISAALGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEEGKIYQRPFGGMTMEFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHAAEFYIEFFAIDLIMDDQGCCRGVIALKLDDGTLHRFRAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLAER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFRGEVVTKKEGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLTINGKQPELPADSADGTLSRL
FT                   DKYRYASGGTPTAKLRESMQQVMQNNCAVFRTGEVLSEGKDLIRKVHGGVGDIGVSDRS
FT                   LVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGAHAREDFPDRDDKQWMKHTLAWIG
FT                   DDGDTTIDYRPVHDYTMTNDVQYIPPKPRVY"
     MAANGNGAPA VNGHAYPIED HVYDVVVVGA GGAGLRAVVG CSEAGLRTAC ITKVFPTRSH        60
     TVAAQGGISA ALGNMHKDDW RWHMYDTVKG SDWLGDQDSI EYMVRNAPEA VYELEHWGVP       120
     FSRTEEGKIY QRPFGGMTME FGKGQAQRTC AAADRTGHAM LHTMYGQALR HAAEFYIEFF       180
     AIDLIMDDQG CCRGVIALKL DDGTLHRFRA QTTILATGGY GRAYASCTSA HTCTGDGGAM       240
     ALRAGLPLQD MEFVQFHPTG IYGSGCLVTE GARGEGGYLV NSEGERFMER YAPSAKDLAS       300
     RDVVSRAMTI EMREGRGVGK KKDHIFLHLD HLAPEVLAER LPGISESARI FAGVDVTREP       360
     IPILPTVHYN MGGIPTNFRG EVVTKKEGDD NAVVPGLMAI GEAACVSVHG ANRLGSNSLI       420
     DLVVFGRAAA LRCAEKLTIN GKQPELPADS ADGTLSRLDK YRYASGGTPT AKLRESMQQV       480
     MQNNCAVFRT GEVLSEGKDL IRKVHGGVGD IGVSDRSLVW NSDLVETLEF DNLIIQAVVT       540
     MNSAANRTES RGAHAREDFP DRDDKQWMKH TLAWIGDDGD TTIDYRPVHD YTMTNDVQYI       600
     PPKPRVY                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page