(data stored in ACNUC7421 zone)

EMBL: CP000283.PE479

CP000283.PE479       Location/Qualifiers
FT   CDS             complement(555345..555734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0481"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37719"
FT                   /db_xref="GOA:Q13DX0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX0"
FT                   /protein_id="ABE37719.1"
FT                   /translation="MIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIA
FT                   CAAGPASYANLQAFTGSWIGRLILFGYTWSLMHHLLSGVRHFVWDLGYGFKTADREWLT
FT                   WAALIGGVVLTVLFWVIAFSMGVAR"
     MIDRPLSPHM QAYRWSLTMA LSIVHRATGI ALYFGTLLLA WWLIACAAGP ASYANLQAFT        60
     GSWIGRLILF GYTWSLMHHL LSGVRHFVWD LGYGFKTADR EWLTWAALIG GVVLTVLFWV       120
     IAFSMGVAR                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page