(data stored in ACNUC7421 zone)

EMBL: CP000283.PE48

CP000283.PE48        Location/Qualifiers
FT   CDS             complement(60305..61537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0048"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37288"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F51"
FT                   /protein_id="ABE37288.1"
FT                   /translation="MTTKMTRLLRNAALAGAALLATAAQAQDTIKVGALLPLSGNYGFL
FT                   GVTERLGIDMAVEEVNSAGGILGKKVVVVYEDAGTPAQTTRKATQMLEQDKVAFFVNGG
FT                   GSAVSATMFEFAQRNKVIDLAIDPNAEELVTTKAGKYAFLVPAPSSMIANAVIPEAIKL
FT                   GKTAMFLTHDYSFGHAQTGEQRRVLKDKGGVKEVGEIKIPLNTRDFSSQIIAIRNAKPE
FT                   MLIINVAGVDATALLEQIWEFELYKQTKIVVPLLDFEDSWAIGREKNQLIALAGIEWHY
FT                   NVPAADALAFKERYQKQFPKAEYPVPTTNTVNAYLGVRETLRAIQRAGSLDSAKIVAAL
FT                   ENHEVKDSLKPNPLVIRAKDHQWMQDFFVYKMKNPASSKELGDIYELITVAKGADIVVP
FT                   EAQRTTDLNAQ"
     MTTKMTRLLR NAALAGAALL ATAAQAQDTI KVGALLPLSG NYGFLGVTER LGIDMAVEEV        60
     NSAGGILGKK VVVVYEDAGT PAQTTRKATQ MLEQDKVAFF VNGGGSAVSA TMFEFAQRNK       120
     VIDLAIDPNA EELVTTKAGK YAFLVPAPSS MIANAVIPEA IKLGKTAMFL THDYSFGHAQ       180
     TGEQRRVLKD KGGVKEVGEI KIPLNTRDFS SQIIAIRNAK PEMLIINVAG VDATALLEQI       240
     WEFELYKQTK IVVPLLDFED SWAIGREKNQ LIALAGIEWH YNVPAADALA FKERYQKQFP       300
     KAEYPVPTTN TVNAYLGVRE TLRAIQRAGS LDSAKIVAAL ENHEVKDSLK PNPLVIRAKD       360
     HQWMQDFFVY KMKNPASSKE LGDIYELITV AKGADIVVPE AQRTTDLNAQ                  410
//

If you have problems or comments...

PBIL Back to PBIL home page