(data stored in ACNUC7421 zone)

EMBL: CP000283.PE484

CP000283.PE484       Location/Qualifiers
FT   CDS             561057..561701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37724"
FT                   /db_xref="GOA:Q13DW5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW5"
FT                   /protein_id="ABE37724.1"
FT                   /translation="MSSMTVSEQANAGQAGEETVRKVIQPAWVRIMHWINAVAMIVMIM
FT                   SGWQIYNASPLFDFQFSRSVTLGGWLGGGLLWHFAAMWVLMINGLLYLVVGLATGRFRR
FT                   KLLPITPSGVASDLAKAATFRLSHRDLTTYNYVQKLLYAGIMGVGIVVVLSGLSIWKPV
FT                   QFQLLTAVFGGYDTARYVHFFAMASIVAFLIVHIALAVLVPKSLRAMIIGR"
     MSSMTVSEQA NAGQAGEETV RKVIQPAWVR IMHWINAVAM IVMIMSGWQI YNASPLFDFQ        60
     FSRSVTLGGW LGGGLLWHFA AMWVLMINGL LYLVVGLATG RFRRKLLPIT PSGVASDLAK       120
     AATFRLSHRD LTTYNYVQKL LYAGIMGVGI VVVLSGLSIW KPVQFQLLTA VFGGYDTARY       180
     VHFFAMASIV AFLIVHIALA VLVPKSLRAM IIGR                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page