(data stored in ACNUC7421 zone)

EMBL: CP000283.PE489

CP000283.PE489       Location/Qualifiers
FT   CDS             complement(565977..566357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37729"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW0"
FT                   /protein_id="ABE37729.1"
FT                   /translation="MTLKFPAARTFAVLLASAAVVAIGLDTANAQQQPTKRVYQTNDQA
FT                   RYGARGPNASYQAGPRTRVYVTKRSWLDAGTEVLPGDRKFTDYAFPPGTSFSRQNGQRT
FT                   IDRAPLNPASDLGGYPERFPLY"
     MTLKFPAART FAVLLASAAV VAIGLDTANA QQQPTKRVYQ TNDQARYGAR GPNASYQAGP        60
     RTRVYVTKRS WLDAGTEVLP GDRKFTDYAF PPGTSFSRQN GQRTIDRAPL NPASDLGGYP       120
     ERFPLY                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page