(data stored in ACNUC7421 zone)

EMBL: CP000283.PE490

CP000283.PE490       Location/Qualifiers
FT   CDS             complement(566522..567340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37730"
FT                   /db_xref="GOA:Q13DV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV9"
FT                   /protein_id="ABE37730.1"
FT                   /translation="MRPNPALPAAPHRGRIHPALRSFADECRETVVRLLAYVGALALIG
FT                   LIVFYAANPLTDAAITAAAEPAARAGWSGAMRSHPAFAVSQIDLPGATASTEILRHPDG
FT                   GRKDILRWALAGQPPVAEITLYRPGNEARAEVQGLPDIVADIAARLDPGGGGAAQPAGL
FT                   IDSKFGTVALFDLAGRANRCFGFFKPIDEASLRISGWTCRGDSLPQRRAAAGCMLDRLV
FT                   LLSAGGDTALAETFARAELRRQGCKDGQSQQDAGADWVLGAQNPRLRGTF"
     MRPNPALPAA PHRGRIHPAL RSFADECRET VVRLLAYVGA LALIGLIVFY AANPLTDAAI        60
     TAAAEPAARA GWSGAMRSHP AFAVSQIDLP GATASTEILR HPDGGRKDIL RWALAGQPPV       120
     AEITLYRPGN EARAEVQGLP DIVADIAARL DPGGGGAAQP AGLIDSKFGT VALFDLAGRA       180
     NRCFGFFKPI DEASLRISGW TCRGDSLPQR RAAAGCMLDR LVLLSAGGDT ALAETFARAE       240
     LRRQGCKDGQ SQQDAGADWV LGAQNPRLRG TF                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page