(data stored in ACNUC7421 zone)

EMBL: CP000283.PE492

CP000283.PE492       Location/Qualifiers
FT   CDS             568675..569241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0494"
FT                   /product="Uncharacterized protein UPF0114"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37732"
FT                   /db_xref="GOA:Q13DV7"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV7"
FT                   /protein_id="ABE37732.1"
FT                   /translation="MTDQPDLPKSPSPIKRVERGFETLLFNSRWLMAPFYFGLVLSLLV
FT                   LLYKFVVLLAELILHASLAKESDIILGVLSLIDVSLTGNLVLIVVFSGYENFVSRIDPR
FT                   DHPDWPEWMTKVDFAGLKQKLLASIVAISAIQVLKAFMNLDAGYDPTRLGWLVGIHLVF
FT                   VVSTLLMALSDRWGSDHGSGDKAGH"
     MTDQPDLPKS PSPIKRVERG FETLLFNSRW LMAPFYFGLV LSLLVLLYKF VVLLAELILH        60
     ASLAKESDII LGVLSLIDVS LTGNLVLIVV FSGYENFVSR IDPRDHPDWP EWMTKVDFAG       120
     LKQKLLASIV AISAIQVLKA FMNLDAGYDP TRLGWLVGIH LVFVVSTLLM ALSDRWGSDH       180
     GSGDKAGH                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page