(data stored in ACNUC7421 zone)

EMBL: CP000283.PE496

CP000283.PE496       Location/Qualifiers
FT   CDS             complement(573397..574002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0498"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37736"
FT                   /db_xref="GOA:Q13DV3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DV3"
FT                   /protein_id="ABE37736.1"
FT                   /translation="MDKFTTLEGVAAPLKIINVDTDMIIPKQYLKTIKRTGLGKGLFSE
FT                   QRYNDDGSENPDFILNKPAYRNAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFG
FT                   DIFYNNCFKNGVLPIRVSQADLDKLFDDAERGSNATVTIDLPAQEIRGPDGGTVKFEID
FT                   PFRKHCLINGLDDIGLTLEKKASIDSYEDKAKTERAWA"
     MDKFTTLEGV AAPLKIINVD TDMIIPKQYL KTIKRTGLGK GLFSEQRYND DGSENPDFIL        60
     NKPAYRNAKI LVAGDNFGCG SSREHAPWAL LDFGIRCVIS TSFGDIFYNN CFKNGVLPIR       120
     VSQADLDKLF DDAERGSNAT VTIDLPAQEI RGPDGGTVKF EIDPFRKHCL INGLDDIGLT       180
     LEKKASIDSY EDKAKTERAW A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page