(data stored in ACNUC7421 zone)

EMBL: CP000283.PE498

CP000283.PE498       Location/Qualifiers
FT   CDS             574610..574948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37738"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV1"
FT                   /protein_id="ABE37738.1"
FT                   /translation="MIRRMTLAAAGLGLAVSLLLQAAEPAQAQTPKPARPSVSSAPADL
FT                   SPTDLSSQQRRPPRRLRIYPRNAPDGVYPRFNPGPNAVRECTATYVQEYRPSGTVITPR
FT                   MSCFWRRG"
     MIRRMTLAAA GLGLAVSLLL QAAEPAQAQT PKPARPSVSS APADLSPTDL SSQQRRPPRR        60
     LRIYPRNAPD GVYPRFNPGP NAVRECTATY VQEYRPSGTV ITPRMSCFWR RG               112
//

If you have problems or comments...

PBIL Back to PBIL home page