(data stored in ACNUC7421 zone)

EMBL: CP000283.PE499

CP000283.PE499       Location/Qualifiers
FT   CDS             575449..575742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV0"
FT                   /protein_id="ABE37739.1"
FT                   /translation="MNILKLTGLAAVAGLLLIAAPGDRAQAAPMAAAGLATSVQRDVIS
FT                   DVSEVQYRHHHHGYRHHRHVRPHHYRGHHYGHRSHRHYGAPRHHHRHHRHWR"
     MNILKLTGLA AVAGLLLIAA PGDRAQAAPM AAAGLATSVQ RDVISDVSEV QYRHHHHGYR        60
     HHRHVRPHHY RGHHYGHRSH RHYGAPRHHH RHHRHWR                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page