(data stored in ACNUC7421 zone)

EMBL: CP000283.PE507

CP000283.PE507       Location/Qualifiers
FT   CDS             complement(581096..581419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0509"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37747"
FT                   /db_xref="GOA:Q13DU2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DU2"
FT                   /protein_id="ABE37747.1"
FT                   /translation="MSVVIRLARAGTKKRPFYHVVVADSRFPRDGRFIERLGYFNPLMA
FT                   KDNEARLKLDLDKVKDWLAKGAQPSDRVARFLDTAGIKKREARNNPEKAVPRKERKAAE
FT                   AGK"
     MSVVIRLARA GTKKRPFYHV VVADSRFPRD GRFIERLGYF NPLMAKDNEA RLKLDLDKVK        60
     DWLAKGAQPS DRVARFLDTA GIKKREARNN PEKAVPRKER KAAEAGK                     107
//

If you have problems or comments...

PBIL Back to PBIL home page