(data stored in ACNUC7421 zone)

EMBL: CP000283.PE513

CP000283.PE513       Location/Qualifiers
FT   CDS             587134..588465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0515"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37753"
FT                   /db_xref="GOA:Q13DT6"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT6"
FT                   /protein_id="ABE37753.1"
FT                   /translation="MAVEIVTFGCRLNAFESEVIRREAEGAGLHDAIVINSCAVTNEAV
FT                   AQARQQIRKLKRERPGARIVVTGCAAQTEPATFAGMDEVDRVIGNDDKMRSEAWRAARI
FT                   AFDADTAFGLGAEQKIAVADIMAVREMAPHLVDGYQSGLPRVFVQVQNGCDHRCTFCII
FT                   PFGRGNSRSVPIGAVVDQVRALTERGHAEIVLTGVDLTSYGADLPGTPKLGALVKKVLR
FT                   HVPELQRLRISSIDSIEADRDLLDALAGEQRLMPHLHLSLQAGDDLILKRMKRRHLRDD
FT                   AIAFCEEVRRLRPDIALGADLIAGFPTETEAMFRRSLDLVDDCGLTFLHVFPYSKRPGT
FT                   PAARMPQLDGRIIRERAARLRAAGEAALQRRLQAEIGQTRAVLIESATQGRTEHFIPVA
FT                   MSGATPGTVQSLTIAGHDGARLTTTRRSSHTPQAAGADAAAAAR"
     MAVEIVTFGC RLNAFESEVI RREAEGAGLH DAIVINSCAV TNEAVAQARQ QIRKLKRERP        60
     GARIVVTGCA AQTEPATFAG MDEVDRVIGN DDKMRSEAWR AARIAFDADT AFGLGAEQKI       120
     AVADIMAVRE MAPHLVDGYQ SGLPRVFVQV QNGCDHRCTF CIIPFGRGNS RSVPIGAVVD       180
     QVRALTERGH AEIVLTGVDL TSYGADLPGT PKLGALVKKV LRHVPELQRL RISSIDSIEA       240
     DRDLLDALAG EQRLMPHLHL SLQAGDDLIL KRMKRRHLRD DAIAFCEEVR RLRPDIALGA       300
     DLIAGFPTET EAMFRRSLDL VDDCGLTFLH VFPYSKRPGT PAARMPQLDG RIIRERAARL       360
     RAAGEAALQR RLQAEIGQTR AVLIESATQG RTEHFIPVAM SGATPGTVQS LTIAGHDGAR       420
     LTTTRRSSHT PQAAGADAAA AAR                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page