(data stored in ACNUC7421 zone)

EMBL: CP000283.PE515

CP000283.PE515       Location/Qualifiers
FT   CDS             589326..590273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0517"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37755"
FT                   /db_xref="GOA:Q13DT4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT4"
FT                   /protein_id="ABE37755.1"
FT                   /translation="MSDTPETQKPSWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAML
FT                   DEIEDVLLRADLGTEVASRISDAVGEGRYDKMISASDVKEIVASEVEKVLAPVAKPLVI
FT                   DDAKKPFVVLVVGVNGSGKTTTIGKLSARFAAEGRKVMMAAGDTFRAAAIEQLKVWGER
FT                   TGTPVIAGAQGSDSASLAFNALTAAKEQGRDVLLIDTAGRLQNRKELMSELEKVVRVIK
FT                   KVDDTAPHAVLLVLDATVGQNALSQVEAFTRTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLSPFTARDFAQAIAGTETQ"
     MSDTPETQKP SWWRRLSSGL KRTSSSIGTA LSEFISKRKL DRAMLDEIED VLLRADLGTE        60
     VASRISDAVG EGRYDKMISA SDVKEIVASE VEKVLAPVAK PLVIDDAKKP FVVLVVGVNG       120
     SGKTTTIGKL SARFAAEGRK VMMAAGDTFR AAAIEQLKVW GERTGTPVIA GAQGSDSASL       180
     AFNALTAAKE QGRDVLLIDT AGRLQNRKEL MSELEKVVRV IKKVDDTAPH AVLLVLDATV       240
     GQNALSQVEA FTRTAGVTGL VMTKLDGTAR GGILVAIAEK HKLPVHFIGV GEGVEDLSPF       300
     TARDFAQAIA GTETQ                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page