(data stored in ACNUC7421 zone)

EMBL: CP000283.PE517

CP000283.PE517       Location/Qualifiers
FT   CDS             complement(591159..591551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37757"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT2"
FT                   /protein_id="ABE37757.1"
FT                   /translation="MRTFKLRTLKLRHLTLAPLAAALAFGLLVNAPAMAQAPQTTPQTD
FT                   KMAPPPAATKTSPTAGAKSEKVDLLDINSATVEQLEVLPGIGKAYSAAIIKGRPYKGKD
FT                   ELVQKKVVPEKTYEGIKDKIIAKQKG"
     MRTFKLRTLK LRHLTLAPLA AALAFGLLVN APAMAQAPQT TPQTDKMAPP PAATKTSPTA        60
     GAKSEKVDLL DINSATVEQL EVLPGIGKAY SAAIIKGRPY KGKDELVQKK VVPEKTYEGI       120
     KDKIIAKQKG                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page