(data stored in ACNUC7421 zone)

EMBL: CP000283.PE522

CP000283.PE522       Location/Qualifiers
FT   CDS             complement(594086..594688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0524"
FT                   /product="heme exporter protein CcmA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37762"
FT                   /db_xref="GOA:Q13DS7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DS7"
FT                   /protein_id="ABE37762.1"
FT                   /translation="MWLSGRGLRCVRGGREVFDGLGFEAAGGEALALVGHNGAGKTSLL
FT                   RLIAGLLAPAAGTITFDGGEPDTPVAEQAHYLGHRDALKPSLSVTENLAFWREFLGGEP
FT                   TDLPAAIEAVGLAHAAELPAAYLSAGQRRRLSIARLLVVRRPIWLLDEPTSALDVRGQE
FT                   AFGRLMSDHLAGGGLIIAATHSPLGIAAREMRIGAAA"
     MWLSGRGLRC VRGGREVFDG LGFEAAGGEA LALVGHNGAG KTSLLRLIAG LLAPAAGTIT        60
     FDGGEPDTPV AEQAHYLGHR DALKPSLSVT ENLAFWREFL GGEPTDLPAA IEAVGLAHAA       120
     ELPAAYLSAG QRRRLSIARL LVVRRPIWLL DEPTSALDVR GQEAFGRLMS DHLAGGGLII       180
     AATHSPLGIA AREMRIGAAA                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page