(data stored in ACNUC7421 zone)

EMBL: CP000283.PE527

CP000283.PE527       Location/Qualifiers
FT   CDS             complement(600372..601163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0529"
FT                   /product="protein of unknown function UPF0005"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37767"
FT                   /db_xref="GOA:Q13DS2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS2"
FT                   /protein_id="ABE37767.1"
FT                   /translation="MSDLDRNYASPFGRAAGRVDSAAVDAGLRAYMLRIYNYMTIGLAI
FT                   TGLAALGVYMGAVTPNDVGAAGRIGNTYLTTFGVAMFASPLKWVFILAPLAMVFAISFG
FT                   INRLKPATAQLLFWAFAALMGISLSSIFLVYTHTSIVRVFFITAASFGALSLYGYTTKR
FT                   DMTGMGSFLIMGLFGVVIASVVNLFVASSMLQFIVSVVGVLVFAGLTAWDTQRLKNDYI
FT                   YGYASEGGEVAERAAITGALSLYLNFINLFTLLLQLLGQKE"
     MSDLDRNYAS PFGRAAGRVD SAAVDAGLRA YMLRIYNYMT IGLAITGLAA LGVYMGAVTP        60
     NDVGAAGRIG NTYLTTFGVA MFASPLKWVF ILAPLAMVFA ISFGINRLKP ATAQLLFWAF       120
     AALMGISLSS IFLVYTHTSI VRVFFITAAS FGALSLYGYT TKRDMTGMGS FLIMGLFGVV       180
     IASVVNLFVA SSMLQFIVSV VGVLVFAGLT AWDTQRLKND YIYGYASEGG EVAERAAITG       240
     ALSLYLNFIN LFTLLLQLLG QKE                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page