(data stored in ACNUC7421 zone)

EMBL: CP000283.PE528

CP000283.PE528       Location/Qualifiers
FT   CDS             complement(601496..604090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0530"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37768"
FT                   /db_xref="GOA:Q13DS1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS1"
FT                   /protein_id="ABE37768.1"
FT                   /translation="MTLAADPLAKSPSTSAPTSRGLSLPLRYALREMRGGLNGFYVFIA
FT                   CIALGVMAIAGVGSVAASLGDGLAREGRTLLGGDVAFSLIQREATAEELGYLRERGPVS
FT                   VAATLRGMARTAAGQSALVEIKAVDNLYPMLGELKLAPQLPTAEVLAERDGAFGAAADA
FT                   ALLARLDLKIGDRVTVGSAAFQIRSVVASEPDKLAGNVGFGPRFLISDAALRATQLLQP
FT                   GSLVRWIYRVRLPDNRADDKAAQAFADATRAALPQAGWEIRSRGNASPQLERTITRFTQ
FT                   FLTLVGLAALLVGGVGVANAVKSHIDRRRDVIAAFKALGATGHDVFAIYLTQVLVLATI
FT                   GSLIGLALGAALPFVITGLFGKLLPLPVVAALHPEELALSLVYGLLTALAFGLWPLAQV
FT                   RDVPVATLFREAATADAHRPKFRHIVWIGVVIALLLAVVIGLAYDKRVAIAFVVAAVVV
FT                   FALLRGVAAGLMAIARWLPRSRITMLRLAIANIHRPGALTPSVVLSLGLGLAVLVTISQ
FT                   IDGNLRRQFLAALPERAPTFFFIDIPSSETEQFSGFLTRIAPKATLEDVPMLRGRIVAA
FT                   RGVRAEDLKPGQDAEWVLQSDRGLTYAAEMPAGSKVVEGHWWPKDYDGKPLVSFEKKLA
FT                   DGLGLKIGDSVTVNVLGREITATISNLRSVDWQSLGINFVLVFSPNTFRGAPHTHIATL
FT                   TETGSTPESDAALIKQVADKFPMVTSVRVREALETVGGVVSNLALAVRGASSVTLISAI
FT                   LVLGGALAAGHRHRVYDAVILKTLGATRGRLIGAFALEYMMIGLATAVFGVIAGSAAAW
FT                   LIVTRLMSLSFAWQAGSAAGVVVAALVVTVGLGLVGTLLALNQKPASVLRNL"
     MTLAADPLAK SPSTSAPTSR GLSLPLRYAL REMRGGLNGF YVFIACIALG VMAIAGVGSV        60
     AASLGDGLAR EGRTLLGGDV AFSLIQREAT AEELGYLRER GPVSVAATLR GMARTAAGQS       120
     ALVEIKAVDN LYPMLGELKL APQLPTAEVL AERDGAFGAA ADAALLARLD LKIGDRVTVG       180
     SAAFQIRSVV ASEPDKLAGN VGFGPRFLIS DAALRATQLL QPGSLVRWIY RVRLPDNRAD       240
     DKAAQAFADA TRAALPQAGW EIRSRGNASP QLERTITRFT QFLTLVGLAA LLVGGVGVAN       300
     AVKSHIDRRR DVIAAFKALG ATGHDVFAIY LTQVLVLATI GSLIGLALGA ALPFVITGLF       360
     GKLLPLPVVA ALHPEELALS LVYGLLTALA FGLWPLAQVR DVPVATLFRE AATADAHRPK       420
     FRHIVWIGVV IALLLAVVIG LAYDKRVAIA FVVAAVVVFA LLRGVAAGLM AIARWLPRSR       480
     ITMLRLAIAN IHRPGALTPS VVLSLGLGLA VLVTISQIDG NLRRQFLAAL PERAPTFFFI       540
     DIPSSETEQF SGFLTRIAPK ATLEDVPMLR GRIVAARGVR AEDLKPGQDA EWVLQSDRGL       600
     TYAAEMPAGS KVVEGHWWPK DYDGKPLVSF EKKLADGLGL KIGDSVTVNV LGREITATIS       660
     NLRSVDWQSL GINFVLVFSP NTFRGAPHTH IATLTETGST PESDAALIKQ VADKFPMVTS       720
     VRVREALETV GGVVSNLALA VRGASSVTLI SAILVLGGAL AAGHRHRVYD AVILKTLGAT       780
     RGRLIGAFAL EYMMIGLATA VFGVIAGSAA AWLIVTRLMS LSFAWQAGSA AGVVVAALVV       840
     TVGLGLVGTL LALNQKPASV LRNL                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page