(data stored in ACNUC7421 zone)

EMBL: CP000283.PE534

CP000283.PE534       Location/Qualifiers
FT   CDS             608713..609912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0536"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37774"
FT                   /db_xref="GOA:Q13DR5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DR5"
FT                   /protein_id="ABE37774.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKDYAQQMLHATLVTVQTGPAGKQVN
FT                   RLYVEEGSEIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPAT
FT                   GIMAHHGRAVANTLGLKGEQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCL
FT                   DAKMSFDGNALYRHADIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMTPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVNAVKQVA
FT                   "
     MNIHEYQAKA VLREFGVPVS HGYPIFKASE AEAAAKQLGG PVWVVKSQIH AGGRGKGKFK        60
     EASAGDKGGV RLAKSIDEVK DYAQQMLHAT LVTVQTGPAG KQVNRLYVEE GSEIDKEFYL       120
     SLLVDRATSR ISFVVSTEGG MSIEDVAHDT PEKIVSFTVD PATGIMAHHG RAVANTLGLK       180
     GEQAKQAESL VTKLYTAFLA KDMEMLEINP LVLTKQGDLK CLDAKMSFDG NALYRHADIQ       240
     ALRDETEEDA KEIEASKYDL NYVTLDGTIG CMVNGAGLAM ATMDIIKLYG MTPANFLDVG       300
     GGASKEKVTA AFKIITADPN VKGILINIFG GIMKCDIIAE GVVAAVKEVG LDVPLVVRLE       360
     GTNVEAGKKI IKHSGLNVLP ADNLDDAAQK IVNAVKQVA                              399
//

If you have problems or comments...

PBIL Back to PBIL home page