(data stored in ACNUC7421 zone)

EMBL: CP000283.PE536

CP000283.PE536       Location/Qualifiers
FT   CDS             610186..610605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0538"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37776"
FT                   /db_xref="GOA:Q13DR3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR3"
FT                   /protein_id="ABE37776.1"
FT                   /translation="MSAEAMLDANVLVYAASTAAAEAAKARTATQLLKTGNVGISGQVM
FT                   QEFYVTVTRKSPTPLSVDDALDWLDVFNELPCIPVDAALVRSGAEIAQRYQISYWDGAV
FT                   LAAAHRLNATVLYSEDLSHDQTYGSVRVVNPFRAN"
     MSAEAMLDAN VLVYAASTAA AEAAKARTAT QLLKTGNVGI SGQVMQEFYV TVTRKSPTPL        60
     SVDDALDWLD VFNELPCIPV DAALVRSGAE IAQRYQISYW DGAVLAAAHR LNATVLYSED       120
     LSHDQTYGSV RVVNPFRAN                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page