(data stored in ACNUC7421 zone)

EMBL: CP000283.PE541

CP000283.PE541       Location/Qualifiers
FT   CDS             614527..615342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0543"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37781"
FT                   /db_xref="GOA:Q13DQ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ8"
FT                   /protein_id="ABE37781.1"
FT                   /translation="MSRDLLNTVPPSQLLVIQLTASVAALAGLALPNMPWRYRSRGMLR
FT                   ASAIGILEPGLTYSIGLIGLSLTTAGSASIIGATEPIMIVLIAWLFLSQRPSPRLAVCI
FT                   VIAVIGLLMVSGETLFRPGQGNALGDGLIVLATVSAASYVVLSAKVAAHFPAATLAMAQ
FT                   QLAGLAFVFAVFVVVQAFGLERPILAELSLSIVAYAAVSGIIQYAIAFWLYLIGLRYLT
FT                   PGAAGLWLTLVPVFGIFGAFVWLDEIPTPVMLAGAALIIGAVLIGKAEK"
     MSRDLLNTVP PSQLLVIQLT ASVAALAGLA LPNMPWRYRS RGMLRASAIG ILEPGLTYSI        60
     GLIGLSLTTA GSASIIGATE PIMIVLIAWL FLSQRPSPRL AVCIVIAVIG LLMVSGETLF       120
     RPGQGNALGD GLIVLATVSA ASYVVLSAKV AAHFPAATLA MAQQLAGLAF VFAVFVVVQA       180
     FGLERPILAE LSLSIVAYAA VSGIIQYAIA FWLYLIGLRY LTPGAAGLWL TLVPVFGIFG       240
     AFVWLDEIPT PVMLAGAALI IGAVLIGKAE K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page