(data stored in ACNUC7421 zone)

EMBL: CP000283.PE544

CP000283.PE544       Location/Qualifiers
FT   CDS             620210..620611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37784"
FT                   /db_xref="GOA:Q13DQ5"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ5"
FT                   /protein_id="ABE37784.1"
FT                   /translation="MQPMPIEITVLGWSVVLLIVQMFLASVPAMLELGGPYQAGPRDEG
FT                   KVAQGRFAGRANRAFRNLLETYPAFVALALALAVTGKTGGYAATAAVIWLVARVLYAPL
FT                   YIIEIPFARSLVWFVALLALIAMLIRLMS"
     MQPMPIEITV LGWSVVLLIV QMFLASVPAM LELGGPYQAG PRDEGKVAQG RFAGRANRAF        60
     RNLLETYPAF VALALALAVT GKTGGYAATA AVIWLVARVL YAPLYIIEIP FARSLVWFVA       120
     LLALIAMLIR LMS                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page