(data stored in ACNUC7421 zone)

EMBL: CP000283.PE546

CP000283.PE546       Location/Qualifiers
FT   CDS             621392..621646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0548"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37786"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ3"
FT                   /protein_id="ABE37786.1"
FT                   /translation="MPVVAMVDGVKIEFYPDEHPPPHFHARYAEHVAQIEIRTAKVLRG
FT                   SLPPAKLGRVLSWASRHYMGLMDAWTAVEELRKPEKIDD"
     MPVVAMVDGV KIEFYPDEHP PPHFHARYAE HVAQIEIRTA KVLRGSLPPA KLGRVLSWAS        60
     RHYMGLMDAW TAVEELRKPE KIDD                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page