(data stored in ACNUC7421 zone)

EMBL: CP000283.PE547

CP000283.PE547       Location/Qualifiers
FT   CDS             621639..621929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37787"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ2"
FT                   /protein_id="ABE37787.1"
FT                   /translation="MTEIVAIQSAEPVIFGVLKIVWSDGFEGVVDLRPLIAKGEMFEFL
FT                   RAAPARFATVQREPYGHKIFWLDDQGDEIDFGSSSLRQRAERQAGLLHLAS"
     MTEIVAIQSA EPVIFGVLKI VWSDGFEGVV DLRPLIAKGE MFEFLRAAPA RFATVQREPY        60
     GHKIFWLDDQ GDEIDFGSSS LRQRAERQAG LLHLAS                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page