(data stored in ACNUC7421 zone)

EMBL: CP000283.PE55

CP000283.PE55        Location/Qualifiers
FT   CDS             complement(67486..67848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37295"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F44"
FT                   /protein_id="ABE37295.1"
FT                   /translation="MRLAPSWIIRQSQLLASTERAAEQSVAPTFAECGHSPLEGWTPHS
FT                   ARQKMQLPVSSHPHRDIVLSAAAPGHIVDACEKSRPNQPRSRIDVVDICLQTTPSPASA
FT                   VSPHRSREPRKSLTSN"
     MRLAPSWIIR QSQLLASTER AAEQSVAPTF AECGHSPLEG WTPHSARQKM QLPVSSHPHR        60
     DIVLSAAAPG HIVDACEKSR PNQPRSRIDV VDICLQTTPS PASAVSPHRS REPRKSLTSN       120
//

If you have problems or comments...

PBIL Back to PBIL home page