(data stored in ACNUC7421 zone)

EMBL: CP000283.PE550

CP000283.PE550       Location/Qualifiers
FT   CDS             complement(624018..624608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37790"
FT                   /db_xref="GOA:Q13DP9"
FT                   /db_xref="InterPro:IPR025570"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DP9"
FT                   /protein_id="ABE37790.1"
FT                   /translation="MGAHESMEHAEHAEHASGSNKNIALLISVIALFLAFSETLGKASQ
FT                   TESIAKNVEASNLWAFFQAKSIRRTVVQTVSEEARLSMGTIGDAAAKAALQKQIEEWQK
FT                   TAQRYRSEPETGEGSEQLAERAKHAEHARDLAQARYHHYELASAAFQIGIVLASATIIT
FT                   GMLALAWISGLLALTGLGFTAIGLFAPHAVHLF"
     MGAHESMEHA EHAEHASGSN KNIALLISVI ALFLAFSETL GKASQTESIA KNVEASNLWA        60
     FFQAKSIRRT VVQTVSEEAR LSMGTIGDAA AKAALQKQIE EWQKTAQRYR SEPETGEGSE       120
     QLAERAKHAE HARDLAQARY HHYELASAAF QIGIVLASAT IITGMLALAW ISGLLALTGL       180
     GFTAIGLFAP HAVHLF                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page