(data stored in ACNUC7421 zone)

EMBL: CP000283.PE555

CP000283.PE555       Location/Qualifiers
FT   CDS             629944..631476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0557"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37795"
FT                   /db_xref="GOA:Q13DP4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP4"
FT                   /protein_id="ABE37795.1"
FT                   /translation="MDIRAAEISAILKDQIKNFGQEAEVTEVGQVLSVGDGIARVYGLD
FT                   NVLAGEMVEFENGTRGMALNLETDNVGIVIFGADREIKEGQTVKRTRSIVDTPVGKGLL
FT                   GRVVDALGNPIDGKGPIQATERKRVDVKAPGIIPRKSVNEPMATGLKAIDALIPVGRGQ
FT                   RELIIGDRQTGKTAIALDTILNQKPLNVEGAPEGQKLYCVYVAVGQKRSTVAQFVKVLE
FT                   EQGALEYSIVVAATASDPAPMQYIAPFTGCTMGEYFRDNGMHAVIIYDDLSKQAVAYRQ
FT                   MSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNEDHGSGSLTALPIIETQANDVSAYIP
FT                   TNVISITDGQIFLETDLFFQGIRPAVNVGLSVSRVGSSAQTKAMKKVAGKIKGELAQYR
FT                   EMAAFAQFGSDLDASTQRLLNRGSRLTELLKQPQFSPLKMEEQVVVIYAGVNGYLDALP
FT                   VAKVRSFEDGLLSLLRGKESAILDAIRTSRDLSDDTAAKLKAVIESYAKTFA"
     MDIRAAEISA ILKDQIKNFG QEAEVTEVGQ VLSVGDGIAR VYGLDNVLAG EMVEFENGTR        60
     GMALNLETDN VGIVIFGADR EIKEGQTVKR TRSIVDTPVG KGLLGRVVDA LGNPIDGKGP       120
     IQATERKRVD VKAPGIIPRK SVNEPMATGL KAIDALIPVG RGQRELIIGD RQTGKTAIAL       180
     DTILNQKPLN VEGAPEGQKL YCVYVAVGQK RSTVAQFVKV LEEQGALEYS IVVAATASDP       240
     APMQYIAPFT GCTMGEYFRD NGMHAVIIYD DLSKQAVAYR QMSLLLRRPP GREAYPGDVF       300
     YLHSRLLERA AKLNEDHGSG SLTALPIIET QANDVSAYIP TNVISITDGQ IFLETDLFFQ       360
     GIRPAVNVGL SVSRVGSSAQ TKAMKKVAGK IKGELAQYRE MAAFAQFGSD LDASTQRLLN       420
     RGSRLTELLK QPQFSPLKME EQVVVIYAGV NGYLDALPVA KVRSFEDGLL SLLRGKESAI       480
     LDAIRTSRDL SDDTAAKLKA VIESYAKTFA                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page