(data stored in ACNUC7421 zone)

EMBL: CP000283.PE558

CP000283.PE558       Location/Qualifiers
FT   CDS             634081..634536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0560"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37798"
FT                   /db_xref="GOA:Q13DP1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DP1"
FT                   /protein_id="ABE37798.1"
FT                   /translation="MDPRVKPAGDSRESSSMATFHFDLVSPEQVAFSGEVDQVDIPGAE
FT                   GDFGVLAGHAPVVAVIRPGILTVTAGGAQQKIVVLGGIAEVSEKGLTVLADVATAVADL
FT                   DMQDFAATIATMEQQLPGKVGDVLDRSIERLDHYKSIQHQISTTAMH"
     MDPRVKPAGD SRESSSMATF HFDLVSPEQV AFSGEVDQVD IPGAEGDFGV LAGHAPVVAV        60
     IRPGILTVTA GGAQQKIVVL GGIAEVSEKG LTVLADVATA VADLDMQDFA ATIATMEQQL       120
     PGKVGDVLDR SIERLDHYKS IQHQISTTAM H                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page