(data stored in ACNUC7421 zone)

EMBL: CP000283.PE572

CP000283.PE572       Location/Qualifiers
FT   CDS             complement(646692..647822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0574"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37812"
FT                   /db_xref="GOA:Q13DM7"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DM7"
FT                   /protein_id="ABE37812.1"
FT                   /translation="MARPKLHDFRRLVVKVGSSLLIDSGAGEVRADWLAALAADIAELH
FT                   RGGRDVMIVSSGSIALGRSRLKLPRGALKLEESQAAAAVGQIALARTWSEVLGSHGIGA
FT                   GQILVTLQDTEERRRYLNARSTIAKLLEWRAVPVINENDTVATNEIRYGDNDRLAARVA
FT                   TMASADLLILLSDIDGLYTAPPGSNPDAKLIPEVESVTAEIESMAGAAGSELSRGGMRT
FT                   KIEAAKIATSAGTHMLIASGKIDHPLKAIAEGGPCTWFLTPANPVTARKRWIAGSLEPK
FT                   GTLTIDAGAVSALRAGKSLLPAGVIRVDGQFARGDAVIVRGPDTHEIGRGLVAYDADDA
FT                   DRIKGRSSPDVMMILGISGRAEMIHRDDLVVGTAPG"
     MARPKLHDFR RLVVKVGSSL LIDSGAGEVR ADWLAALAAD IAELHRGGRD VMIVSSGSIA        60
     LGRSRLKLPR GALKLEESQA AAAVGQIALA RTWSEVLGSH GIGAGQILVT LQDTEERRRY       120
     LNARSTIAKL LEWRAVPVIN ENDTVATNEI RYGDNDRLAA RVATMASADL LILLSDIDGL       180
     YTAPPGSNPD AKLIPEVESV TAEIESMAGA AGSELSRGGM RTKIEAAKIA TSAGTHMLIA       240
     SGKIDHPLKA IAEGGPCTWF LTPANPVTAR KRWIAGSLEP KGTLTIDAGA VSALRAGKSL       300
     LPAGVIRVDG QFARGDAVIV RGPDTHEIGR GLVAYDADDA DRIKGRSSPD VMMILGISGR       360
     AEMIHRDDLV VGTAPG                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page