(data stored in ACNUC7421 zone)

EMBL: CP000283.PE574

CP000283.PE574       Location/Qualifiers
FT   CDS             649290..650075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0576"
FT                   /product="LmbE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37814"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DM5"
FT                   /protein_id="ABE37814.1"
FT                   /translation="MNASEYLDGVRHLPLGSLSDLTGGAPWVLLSPHPDDESLGAGGLI
FT                   AAACDAGERVDVVLITDGGASHPQSQQYPRQRMIELRRTELENATSILGLPRDQLHHLG
FT                   LPDTQAPTEGPPFEAAVDAIAAICAHAGAKSLFVTWDGDPHCDHEASARIAEAVCRRNP
FT                   GIALWAFPIWGWHLDPSLPLDRPPPRGFRLDISAQRARKRAAINAHVSQMTGLIDDDPN
FT                   GFRFTDDRLAPFLGQFEHYLKVSPHEPKNRDDPGGILRE"
     MNASEYLDGV RHLPLGSLSD LTGGAPWVLL SPHPDDESLG AGGLIAAACD AGERVDVVLI        60
     TDGGASHPQS QQYPRQRMIE LRRTELENAT SILGLPRDQL HHLGLPDTQA PTEGPPFEAA       120
     VDAIAAICAH AGAKSLFVTW DGDPHCDHEA SARIAEAVCR RNPGIALWAF PIWGWHLDPS       180
     LPLDRPPPRG FRLDISAQRA RKRAAINAHV SQMTGLIDDD PNGFRFTDDR LAPFLGQFEH       240
     YLKVSPHEPK NRDDPGGILR E                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page