(data stored in ACNUC7421 zone)

EMBL: CP000283.PE58

CP000283.PE58        Location/Qualifiers
FT   CDS             69369..69836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0058"
FT                   /product="Tellurite resistance protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37298"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F41"
FT                   /protein_id="ABE37298.1"
FT                   /translation="MPNRRSPGRPSERLLEDFGDEVQQAQNEHLMEGIVAGCALVAYAD
FT                   GWVTPEEHDRMLSLIRGFEPITAFGLDEVTATFEALTKRFATDQRDGEAAAFAAVARVK
FT                   GAARYPALLVGVCCAIAAADGGFDAEERKAALRICEVLGLDPTEFDLADAP"
     MPNRRSPGRP SERLLEDFGD EVQQAQNEHL MEGIVAGCAL VAYADGWVTP EEHDRMLSLI        60
     RGFEPITAFG LDEVTATFEA LTKRFATDQR DGEAAAFAAV ARVKGAARYP ALLVGVCCAI       120
     AAADGGFDAE ERKAALRICE VLGLDPTEFD LADAP                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page