(data stored in ACNUC7421 zone)

EMBL: CP000283.PE580

CP000283.PE580       Location/Qualifiers
FT   CDS             complement(655470..656693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0582"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37820"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL9"
FT                   /protein_id="ABE37820.1"
FT                   /translation="MRRGLVAAAVVSLFGAMAPQFAFGDSGSVKVGVLTDMSGTFADMS
FT                   GSGTVFSVERAIADSGGNVGGKPIKLVVADHQNKADIASSIARKWFSEDGVDVIVNAAG
FT                   SAVALAVVEMAKTYNKTALVTGALSTRLTNESCSPNSIHYGLDTYALSNGAVQALSQQG
FT                   VKSWYFIVADYAFGISMQRDSENFIKAAGGTVKGGIRHPLNSSDFSSYLLQAQASNADV
FT                   IALGSGGSDIVSMIKQAKEFGVGGGSQKLAALALFISDVNSMGVENAQGMNLVEGFYWN
FT                   YDDGSRGFSKPFYDKFKRMPTVYQAADYSGLRHYLKSALDADWTDGKGIVAQMKKGRID
FT                   DFFARGGYIREDGLLIHDLLLARVRKPADIKQPWDYYDILQTIPGDTAFQPLSLSRCEM
FT                   ITGKTAKQ"
     MRRGLVAAAV VSLFGAMAPQ FAFGDSGSVK VGVLTDMSGT FADMSGSGTV FSVERAIADS        60
     GGNVGGKPIK LVVADHQNKA DIASSIARKW FSEDGVDVIV NAAGSAVALA VVEMAKTYNK       120
     TALVTGALST RLTNESCSPN SIHYGLDTYA LSNGAVQALS QQGVKSWYFI VADYAFGISM       180
     QRDSENFIKA AGGTVKGGIR HPLNSSDFSS YLLQAQASNA DVIALGSGGS DIVSMIKQAK       240
     EFGVGGGSQK LAALALFISD VNSMGVENAQ GMNLVEGFYW NYDDGSRGFS KPFYDKFKRM       300
     PTVYQAADYS GLRHYLKSAL DADWTDGKGI VAQMKKGRID DFFARGGYIR EDGLLIHDLL       360
     LARVRKPADI KQPWDYYDIL QTIPGDTAFQ PLSLSRCEMI TGKTAKQ                     407
//

If you have problems or comments...

PBIL Back to PBIL home page