(data stored in ACNUC7421 zone)

EMBL: CP000283.PE581

CP000283.PE581       Location/Qualifiers
FT   CDS             656829..657422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0583"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37821"
FT                   /db_xref="GOA:Q13DL8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL8"
FT                   /protein_id="ABE37821.1"
FT                   /translation="MGKRAENSAAIKERLYVAAAEIVAQVGFAGASVARITDKAGIAQG
FT                   TFYNYFETREAIFEELVPIFGKKLRGHIRSRVGDTFDFYERERIAFDAFFEFLHGNRFF
FT                   ARVLNEAEIFTPAPHHDYFESILKGYRAELARASREGQIRKLSASEVEVISLMLMSART
FT                   YFALHYSKQIHESRKVSSTVTNTYMDVVRRALSP"
     MGKRAENSAA IKERLYVAAA EIVAQVGFAG ASVARITDKA GIAQGTFYNY FETREAIFEE        60
     LVPIFGKKLR GHIRSRVGDT FDFYERERIA FDAFFEFLHG NRFFARVLNE AEIFTPAPHH       120
     DYFESILKGY RAELARASRE GQIRKLSASE VEVISLMLMS ARTYFALHYS KQIHESRKVS       180
     STVTNTYMDV VRRALSP                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page