(data stored in ACNUC7421 zone)

EMBL: CP000283.PE582

CP000283.PE582       Location/Qualifiers
FT   CDS             complement(657601..658662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0584"
FT                   /product="Small GTP-binding protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37822"
FT                   /db_xref="GOA:Q13DL7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL7"
FT                   /protein_id="ABE37822.1"
FT                   /translation="MKFLDEAKVYIRSGDGGNGCVAFRREKFIEFGGPNGGNGGRGGDV
FT                   VVEAADGLNTLIDYRYQQHFKAQKGVNGMGSDRHGANGKDIVLKVPVGTQIIDEDKETL
FT                   LHDFTKVGERFVLAEGGNGGFGNAHFKSSTNRAPRHANPGLPGEERWIWLRLKLIADAG
FT                   LVGLPNAGKSTFLSKVSAAKPKIADYPFTTLHPQLGVVNSDGREFVLADIPGLIEGAHE
FT                   GAGLGDRFLGHVERCRVLLHLIDATCEHAGKAYKTVRGELEAYADTLTDKIEIVALNKI
FT                   DAVEPDELKKQKDRLKRAAKKTPLLISGVTGAGVPEALRALAAVIGEAPVSDKAIGTAQ
FT                   NAADAKPWAPQDV"
     MKFLDEAKVY IRSGDGGNGC VAFRREKFIE FGGPNGGNGG RGGDVVVEAA DGLNTLIDYR        60
     YQQHFKAQKG VNGMGSDRHG ANGKDIVLKV PVGTQIIDED KETLLHDFTK VGERFVLAEG       120
     GNGGFGNAHF KSSTNRAPRH ANPGLPGEER WIWLRLKLIA DAGLVGLPNA GKSTFLSKVS       180
     AAKPKIADYP FTTLHPQLGV VNSDGREFVL ADIPGLIEGA HEGAGLGDRF LGHVERCRVL       240
     LHLIDATCEH AGKAYKTVRG ELEAYADTLT DKIEIVALNK IDAVEPDELK KQKDRLKRAA       300
     KKTPLLISGV TGAGVPEALR ALAAVIGEAP VSDKAIGTAQ NAADAKPWAP QDV              353
//

If you have problems or comments...

PBIL Back to PBIL home page