(data stored in ACNUC7421 zone)

EMBL: CP000283.PE583

CP000283.PE583       Location/Qualifiers
FT   CDS             658841..659761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0585"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37823"
FT                   /db_xref="GOA:Q13DL6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DL6"
FT                   /protein_id="ABE37823.1"
FT                   /translation="MGLFRKISTGPDEHGARAAGIALMLLAMLAFSFGDAVGKKVVATY
FT                   PVGQLLLLRAFAGLVVLAPLIWRQRAAFTRLERPGLQLVRVLISAFEVAAFFLATVYLP
FT                   LADVITFYLASALFVSVGAAVFLGEKIDRPQMIAILIGFLGVLIALQPSPQTMSWPALI
FT                   AILASILFAALMLITRFLRQTPEIALASQQFVGTALLGSALMAPSGWITPAPADWIWFA
FT                   LAGVASAAGLLCVNRSLRLAPASVVIPYQYTMIGFAAAFGWLFFGELPTLSTLIGVVVI
FT                   IGAGLFLALRERKAGNAPPQINERS"
     MGLFRKISTG PDEHGARAAG IALMLLAMLA FSFGDAVGKK VVATYPVGQL LLLRAFAGLV        60
     VLAPLIWRQR AAFTRLERPG LQLVRVLISA FEVAAFFLAT VYLPLADVIT FYLASALFVS       120
     VGAAVFLGEK IDRPQMIAIL IGFLGVLIAL QPSPQTMSWP ALIAILASIL FAALMLITRF       180
     LRQTPEIALA SQQFVGTALL GSALMAPSGW ITPAPADWIW FALAGVASAA GLLCVNRSLR       240
     LAPASVVIPY QYTMIGFAAA FGWLFFGELP TLSTLIGVVV IIGAGLFLAL RERKAGNAPP       300
     QINERS                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page