(data stored in ACNUC7421 zone)

EMBL: CP000283.PE586

CP000283.PE586       Location/Qualifiers
FT   CDS             complement(661176..661448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0588"
FT                   /product="LSU ribosomal protein L27P"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37826"
FT                   /db_xref="GOA:Q13DL3"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DL3"
FT                   /protein_id="ABE37826.1"
FT                   /translation="MAHKKAGGSSRNGRDSAGKRLGIKAYGGEYVIPGNIIARQRGTTW
FT                   HPGLNVGMGTDHTLFAKVEGRVEFRAKANGRTFVSVLPIAAEAAE"
     MAHKKAGGSS RNGRDSAGKR LGIKAYGGEY VIPGNIIARQ RGTTWHPGLN VGMGTDHTLF        60
     AKVEGRVEFR AKANGRTFVS VLPIAAEAAE                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page