(data stored in ACNUC7421 zone)

EMBL: CP000283.PE596

CP000283.PE596       Location/Qualifiers
FT   CDS             676641..677033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0598"
FT                   /product="cytochrome C oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37836"
FT                   /db_xref="GOA:Q13DK3"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DK3"
FT                   /protein_id="ABE37836.1"
FT                   /translation="MTLNSPPVDAHGHDHGHEAHVAAHNHGTLKSYLIGFGLSVVLTAI
FT                   PFWLVMGDVLGNKQATGLVIMAFAAVQIVVHMIYFLHMTTAAEEGWTMMALIFTIVMVV
FT                   IALAGSLWVMHHLTTNMMPAHDMIRR"
     MTLNSPPVDA HGHDHGHEAH VAAHNHGTLK SYLIGFGLSV VLTAIPFWLV MGDVLGNKQA        60
     TGLVIMAFAA VQIVVHMIYF LHMTTAAEEG WTMMALIFTI VMVVIALAGS LWVMHHLTTN       120
     MMPAHDMIRR                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page