(data stored in ACNUC7421 zone)

EMBL: CP000283.PE606

CP000283.PE606       Location/Qualifiers
FT   CDS             complement(687619..688815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0608"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37846"
FT                   /db_xref="GOA:Q13DJ3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ3"
FT                   /protein_id="ABE37846.1"
FT                   /translation="MGPLSGVTILDLTSVLMGPYATQTLADMGANVIKVESPDGDIVRH
FT                   IGPGRTPGMGGMFLNTNRGKRSIVIDLKQDEGRATLLRLAATANVVIYNVRPQAMARLG
FT                   LGYEQFAAANPSIIYVGVFGYGQNGPYAAKPAYDDLIQGAAGVPTLLAAAGDGTPRYVP
FT                   ITIADRIVGLMAVNATLGGLMHQQRTGQGQRIDVPMFESMAEFVLVDHLGGLTYDPPLD
FT                   HGGYARLLSRYRKPYKTSDGYLCVLIYNDKQWRSFFEAIDRNDFLAQPRFANHAARTQH
FT                   IDEIYEEIGGIFLTRTTADWRELLERADIPVMPMHTMESILEDPHLDAVGFFKTLDHPV
FT                   EGRIRQTQVASTWSVTQPQAGGPAPTLGEHARDILGEAGFSTDEIERLGRTKAVHLPG"
     MGPLSGVTIL DLTSVLMGPY ATQTLADMGA NVIKVESPDG DIVRHIGPGR TPGMGGMFLN        60
     TNRGKRSIVI DLKQDEGRAT LLRLAATANV VIYNVRPQAM ARLGLGYEQF AAANPSIIYV       120
     GVFGYGQNGP YAAKPAYDDL IQGAAGVPTL LAAAGDGTPR YVPITIADRI VGLMAVNATL       180
     GGLMHQQRTG QGQRIDVPMF ESMAEFVLVD HLGGLTYDPP LDHGGYARLL SRYRKPYKTS       240
     DGYLCVLIYN DKQWRSFFEA IDRNDFLAQP RFANHAARTQ HIDEIYEEIG GIFLTRTTAD       300
     WRELLERADI PVMPMHTMES ILEDPHLDAV GFFKTLDHPV EGRIRQTQVA STWSVTQPQA       360
     GGPAPTLGEH ARDILGEAGF STDEIERLGR TKAVHLPG                               398
//

If you have problems or comments...

PBIL Back to PBIL home page