(data stored in ACNUC7421 zone)

EMBL: CP000283.PE607

CP000283.PE607       Location/Qualifiers
FT   CDS             689010..690035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0609"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37847"
FT                   /db_xref="GOA:Q13DJ2"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DJ2"
FT                   /protein_id="ABE37847.1"
FT                   /translation="MRRTLGLSVAVSLSVTMALTSAQALELKVADSFPAGHYLVRLMLK
FT                   PWMDDVTKRTNGAVTFSYYPNQQMGKATDLLRLTQSGVVDIGYIAPSYASDKMPLSEVA
FT                   QLPESFSTSCQGTLAYWKSAREGVLAQKEYAPNKIKLLMAVVLPPYQVFTVKNKIESIS
FT                   DIQGLKLRTTGGAQDLTLRALGAVPVRMSAPDAYESLARGTMDGVLFPADSIPSYGLDK
FT                   LVKHATDGVSFGSFIVAYSISQAAWNKLPADVKAAMDEASEAIEPKVCADVDKEQAQTR
FT                   KQLNDAGVAYDPIPDATKAQMKDRLKGVSVEWAAAIDARGKPASEALKEFESLLAASAN
FT                   K"
     MRRTLGLSVA VSLSVTMALT SAQALELKVA DSFPAGHYLV RLMLKPWMDD VTKRTNGAVT        60
     FSYYPNQQMG KATDLLRLTQ SGVVDIGYIA PSYASDKMPL SEVAQLPESF STSCQGTLAY       120
     WKSAREGVLA QKEYAPNKIK LLMAVVLPPY QVFTVKNKIE SISDIQGLKL RTTGGAQDLT       180
     LRALGAVPVR MSAPDAYESL ARGTMDGVLF PADSIPSYGL DKLVKHATDG VSFGSFIVAY       240
     SISQAAWNKL PADVKAAMDE ASEAIEPKVC ADVDKEQAQT RKQLNDAGVA YDPIPDATKA       300
     QMKDRLKGVS VEWAAAIDAR GKPASEALKE FESLLAASAN K                           341
//

If you have problems or comments...

PBIL Back to PBIL home page