(data stored in ACNUC7421 zone)

EMBL: CP000283.PE620

CP000283.PE620       Location/Qualifiers
FT   CDS             complement(704817..705644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0622"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37860"
FT                   /db_xref="GOA:Q13DH9"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH9"
FT                   /protein_id="ABE37860.1"
FT                   /translation="MRPTVQTTTTRTWRNGRMQDGARAIPEETPVAISYNGGTHAVMMA
FT                   TPADLEDFAIGFSLSEGVIDTPSQIDTFEIVPLDDGIELRMWIGGAEAERLQQRRRHIA
FT                   GPTGCGLCGVDSITEALRPAAIVGAGGHFAPEQIIAAIEAMPPLQTLNIETRAVHAAAF
FT                   WTSARGIVSLREDVGRHNALDKLAGALARQQIATGDGIVLLTSRVSVEMVQKTAALGAP
FT                   LLVAVSAPTALAVRMAEAAGVTLAAIARADGFEVFSHPGRISGGTHEEATDVA"
     MRPTVQTTTT RTWRNGRMQD GARAIPEETP VAISYNGGTH AVMMATPADL EDFAIGFSLS        60
     EGVIDTPSQI DTFEIVPLDD GIELRMWIGG AEAERLQQRR RHIAGPTGCG LCGVDSITEA       120
     LRPAAIVGAG GHFAPEQIIA AIEAMPPLQT LNIETRAVHA AAFWTSARGI VSLREDVGRH       180
     NALDKLAGAL ARQQIATGDG IVLLTSRVSV EMVQKTAALG APLLVAVSAP TALAVRMAEA       240
     AGVTLAAIAR ADGFEVFSHP GRISGGTHEE ATDVA                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page