(data stored in ACNUC7421 zone)

EMBL: CP000283.PE621

CP000283.PE621       Location/Qualifiers
FT   CDS             complement(705647..708493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0623"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37861"
FT                   /db_xref="GOA:Q13DH8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH8"
FT                   /protein_id="ABE37861.1"
FT                   /translation="MALVHEIDFGTPRSPSETMVTLTIDGRSVSVPEGTSIMRAAMEIG
FT                   TAIPKLCATDMVDAFGSCRLCLVEIDGRSGTPASCTTPVADGLVVKTQTERLKQIRKGV
FT                   MELYISDHPLDCLTCSANGDCELQDMAGAVGLRDVRYGYSGNKHPNPGLDESNPYFTYD
FT                   ASKCIVCSRCVRACEEVQGTFALTIAGRGFGSVVSPGMQESFLGSECVSCGACVQACPT
FT                   ATLNEKSVIEIGTPERSVVTTCAYCGVGCTFKAEMRGEEVVRMVPYKDGKANRGHSCVK
FT                   GRFAWGYTNHKERILKPMIRARITDPWREVSWDEAFSHAASELKRIQAKYGRDSIGGIT
FT                   SSRCTNEETFLVQKLIRAGFGNNNVDTCARVCHSPTGYGLSTAFGTSAGTQDFDSVEHT
FT                   DVVMIIGANPTDGHPVFASRLKKRLRAGAKLIVVDPRRIDLVRSAHVEAAQHLPLKPGT
FT                   NVAVLTALAHVIVTEGLANEAFVRERCDWSEYEHWASFVAQPNNSPEATAAMTGVDPQA
FT                   LREAARLYATGGNGAIYYGLGVTEHSQGSTTVMAIANLAMVTGNLGRQGVGVNPLRGQN
FT                   NVQGACDMGSFPHELPGYRHISTDAVRDSFEALWGVTLNSEPGLRIPNMLDAAVDGSFK
FT                   ALYVQGEDILQSDPNTKHVAAGLEAMECVIVHDLFLNETANYAHIFLPGSTFLEKNGTF
FT                   TNAERRIQRVRKVMTPKNGLEDWEVTLRLAEAMGFKMSYDHPSQIMDEIATLTPTFTGV
FT                   SYARLDELGSIQWPCNANAPEGTPVMHIDHFVRGKGKFVITEYVATDERTGPRFPLLLT
FT                   TGRILSQYNVGAQTRRTANTVWHDEDRLEIHPHDAEQRGVRDGDWVRLASRAGETTLRA
FT                   LITDRVAPGVVYTTFHHPDTQANVVTTEYSDWATNCPEYKVTAVQVSPSNGPSEWQRAY
FT                   EEQATAARRIASAAEAAE"
     MALVHEIDFG TPRSPSETMV TLTIDGRSVS VPEGTSIMRA AMEIGTAIPK LCATDMVDAF        60
     GSCRLCLVEI DGRSGTPASC TTPVADGLVV KTQTERLKQI RKGVMELYIS DHPLDCLTCS       120
     ANGDCELQDM AGAVGLRDVR YGYSGNKHPN PGLDESNPYF TYDASKCIVC SRCVRACEEV       180
     QGTFALTIAG RGFGSVVSPG MQESFLGSEC VSCGACVQAC PTATLNEKSV IEIGTPERSV       240
     VTTCAYCGVG CTFKAEMRGE EVVRMVPYKD GKANRGHSCV KGRFAWGYTN HKERILKPMI       300
     RARITDPWRE VSWDEAFSHA ASELKRIQAK YGRDSIGGIT SSRCTNEETF LVQKLIRAGF       360
     GNNNVDTCAR VCHSPTGYGL STAFGTSAGT QDFDSVEHTD VVMIIGANPT DGHPVFASRL       420
     KKRLRAGAKL IVVDPRRIDL VRSAHVEAAQ HLPLKPGTNV AVLTALAHVI VTEGLANEAF       480
     VRERCDWSEY EHWASFVAQP NNSPEATAAM TGVDPQALRE AARLYATGGN GAIYYGLGVT       540
     EHSQGSTTVM AIANLAMVTG NLGRQGVGVN PLRGQNNVQG ACDMGSFPHE LPGYRHISTD       600
     AVRDSFEALW GVTLNSEPGL RIPNMLDAAV DGSFKALYVQ GEDILQSDPN TKHVAAGLEA       660
     MECVIVHDLF LNETANYAHI FLPGSTFLEK NGTFTNAERR IQRVRKVMTP KNGLEDWEVT       720
     LRLAEAMGFK MSYDHPSQIM DEIATLTPTF TGVSYARLDE LGSIQWPCNA NAPEGTPVMH       780
     IDHFVRGKGK FVITEYVATD ERTGPRFPLL LTTGRILSQY NVGAQTRRTA NTVWHDEDRL       840
     EIHPHDAEQR GVRDGDWVRL ASRAGETTLR ALITDRVAPG VVYTTFHHPD TQANVVTTEY       900
     SDWATNCPEY KVTAVQVSPS NGPSEWQRAY EEQATAARRI ASAAEAAE                    948
//

If you have problems or comments...

PBIL Back to PBIL home page