(data stored in ACNUC7421 zone)

EMBL: CP000283.PE623

CP000283.PE623       Location/Qualifiers
FT   CDS             complement(710058..710528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0625"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37863"
FT                   /db_xref="GOA:Q13DH6"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH6"
FT                   /protein_id="ABE37863.1"
FT                   /translation="MKNEPWDTTRAAEIIAGLTHKEGPTLVILHALQEAFGYVPEAAEP
FT                   MVAQALNLSRAEIHGVVTFYPDFRREPPGRHVLKLCRAEACQAAGGDALAAQAETRLGV
FT                   TFGATSADGAVSLEPVYCLGLCATAPSAMLDDRVIGRLDTHRLDALMTEAQR"
     MKNEPWDTTR AAEIIAGLTH KEGPTLVILH ALQEAFGYVP EAAEPMVAQA LNLSRAEIHG        60
     VVTFYPDFRR EPPGRHVLKL CRAEACQAAG GDALAAQAET RLGVTFGATS ADGAVSLEPV       120
     YCLGLCATAP SAMLDDRVIG RLDTHRLDAL MTEAQR                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page