(data stored in ACNUC7421 zone)

EMBL: CP000283.PE628

CP000283.PE628       Location/Qualifiers
FT   CDS             715471..716496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0630"
FT                   /product="transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37868"
FT                   /db_xref="GOA:Q13DH1"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DH1"
FT                   /protein_id="ABE37868.1"
FT                   /translation="MTTRPKPDSRASVVTAALLILVGVLALGSLGVGPVKLSPLTVIDA
FT                   LIGRAGDVQQIIVQQIRLPRAILALAIGGILGLSGAALQGLLRNPLASPSLFGAPQSAA
FT                   FGAVLIIALGWADVRSYALPVAGITMAFVSVFMLLAVAGRSANLLLLILAGLAISSLAG
FT                   AATALVMNLSPNPFASLEIAFWLLGSLEDRSFRHVALALPFILAGGVLLLSQRAAFRAL
FT                   SLGEETAQSLGVDVGRLRLIVIIGVALGVGGAVSVSGTIGFIGLVAPHLVRPLIGHDPA
FT                   RLLVPSALAGAALLLAADIAVRVIPSTTDIKVGVLTSIIGVPFFLYLIVRERRALGGGF
FT                   S"
     MTTRPKPDSR ASVVTAALLI LVGVLALGSL GVGPVKLSPL TVIDALIGRA GDVQQIIVQQ        60
     IRLPRAILAL AIGGILGLSG AALQGLLRNP LASPSLFGAP QSAAFGAVLI IALGWADVRS       120
     YALPVAGITM AFVSVFMLLA VAGRSANLLL LILAGLAISS LAGAATALVM NLSPNPFASL       180
     EIAFWLLGSL EDRSFRHVAL ALPFILAGGV LLLSQRAAFR ALSLGEETAQ SLGVDVGRLR       240
     LIVIIGVALG VGGAVSVSGT IGFIGLVAPH LVRPLIGHDP ARLLVPSALA GAALLLAADI       300
     AVRVIPSTTD IKVGVLTSII GVPFFLYLIV RERRALGGGF S                           341
//

If you have problems or comments...

PBIL Back to PBIL home page