(data stored in ACNUC7421 zone)

EMBL: CP000283.PE630

CP000283.PE630       Location/Qualifiers
FT   CDS             717279..718118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0632"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37870"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG9"
FT                   /protein_id="ABE37870.1"
FT                   /translation="MRRRALSALVVALAAAVLSGAVAAPLPRLASINVCTDQLLMTLAD
FT                   PEQILGLSPYARDEARSFLANKAAAFPMLSGEAEDVLMLKPDIVVTGRYTKRATRELLK
FT                   QQGQRVIEFDTPRTLDEVKALIRTMGDLVGHPDRAVAANARIDTATATARKAASDKAFR
FT                   VLPLERRGWVSGGDSLMTSLLSTVGLVNAASALGIKLGGFASLEAVVSLRPDYLLISED
FT                   GDFAEDEGRAFVLHPALERFYPPSKRITIPERLTVCGGPMLADALDHLSAELSRVEH"
     MRRRALSALV VALAAAVLSG AVAAPLPRLA SINVCTDQLL MTLADPEQIL GLSPYARDEA        60
     RSFLANKAAA FPMLSGEAED VLMLKPDIVV TGRYTKRATR ELLKQQGQRV IEFDTPRTLD       120
     EVKALIRTMG DLVGHPDRAV AANARIDTAT ATARKAASDK AFRVLPLERR GWVSGGDSLM       180
     TSLLSTVGLV NAASALGIKL GGFASLEAVV SLRPDYLLIS EDGDFAEDEG RAFVLHPALE       240
     RFYPPSKRIT IPERLTVCGG PMLADALDHL SAELSRVEH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page