(data stored in ACNUC7421 zone)

EMBL: CP000283.PE637

CP000283.PE637       Location/Qualifiers
FT   CDS             complement(726848..727435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0639"
FT                   /product="protein of unknown function DUF1636"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37877"
FT                   /db_xref="InterPro:IPR012863"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DG2"
FT                   /protein_id="ABE37877.1"
FT                   /translation="MVLWRRRGGVHRTDSRAVAHRSSPRAIRQSSKPQGVAESQGMDRS
FT                   PDHDHTTAPTAELQTDITTDGSTRPAGPVVISVCISCKAADGSNAGAPMLDAIRAAQGG
FT                   AADLRVRPVQCLSVCKRAATVAVSSADGYSFVFGDLVPETGADAIIGFAAAYQHSDYGL
FT                   VPWRQRADVLRKGMVARLPPLRWSPDDGRAPS"
     MVLWRRRGGV HRTDSRAVAH RSSPRAIRQS SKPQGVAESQ GMDRSPDHDH TTAPTAELQT        60
     DITTDGSTRP AGPVVISVCI SCKAADGSNA GAPMLDAIRA AQGGAADLRV RPVQCLSVCK       120
     RAATVAVSSA DGYSFVFGDL VPETGADAII GFAAAYQHSD YGLVPWRQRA DVLRKGMVAR       180
     LPPLRWSPDD GRAPS                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page