(data stored in ACNUC7421 zone)

EMBL: CP000283.PE640

CP000283.PE640       Location/Qualifiers
FT   CDS             729640..729906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37880"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DF9"
FT                   /protein_id="ABE37880.1"
FT                   /translation="MTTSRIHIIGIATIAAMGLLAGPALASNQGPQGSVSEPPSAGCSS
FT                   YMKAPDGSWTKIPCAEAGARAAAAKRNNTRTSAQSQDRSESQD"
     MTTSRIHIIG IATIAAMGLL AGPALASNQG PQGSVSEPPS AGCSSYMKAP DGSWTKIPCA        60
     EAGARAAAAK RNNTRTSAQS QDRSESQD                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page