(data stored in ACNUC7421 zone)

EMBL: CP000283.PE653

CP000283.PE653       Location/Qualifiers
FT   CDS             complement(740427..740645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0655"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37893"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DE6"
FT                   /protein_id="ABE37893.1"
FT                   /translation="MLSVLAVALSATVLWLQLIPSWLAFASLGITLAAAGMASDARYGR
FT                   SKSNRTRPAAGRLRNRRSTDGADRSPV"
     MLSVLAVALS ATVLWLQLIP SWLAFASLGI TLAAAGMASD ARYGRSKSNR TRPAAGRLRN        60
     RRSTDGADRS PV                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page