(data stored in ACNUC7421 zone)

EMBL: CP000283.PE661

CP000283.PE661       Location/Qualifiers
FT   CDS             746532..748655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0663"
FT                   /product="Potassium-translocating P-type ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37901"
FT                   /db_xref="GOA:Q13DD8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DD8"
FT                   /protein_id="ABE37901.1"
FT                   /translation="MSAVKTTRRTTGSAMLDPAIVIPAIGSAFVKLDPRAMIKNPVMFV
FT                   VEVVAALTTAIFIKSIVTDGGGDGFGFTLQIILWLWFTVLFANFAEAVAEGRGKAQADT
FT                   LRQTMTNTKAKKLLMEGNYELYEGVPAENLEQGDLVLVEAGDLIPSDGEIIHGVASVNE
FT                   AAITGESAPVIRESGGDRSAVTGGTMVISDRIVVRITAAKGNSFLDRMIKLVEGAARQK
FT                   TPNEIALNILLAGLTIIFVFATVTIPSYAAYAGGQISVVVLAALFVTLIPTTIGALLSA
FT                   IGIAGMDRLVRFNVLAMSGRAVEAAGDVDTLLLDKTGTITLGNRQATAFRPVTGVSEEA
FT                   LADAAQLASLADETPEGRSIVVLAKEKYGLRGRDLAELSATFVPFTAQTRMSGVDAGHS
FT                   SVRKGAVDAILNYVNGGGSRAVASGNAVRALHPGMSDAAREISAIADEVAKAGGTPLAV
FT                   AKDGRLLGVVHLKDIVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAEAGVDDFLA
FT                   QATPEDKLKLIRDEQAKGKLVAMCGDGTNDAPALAQADVGVAMNTGTQAAREAGNMVDL
FT                   DSNPTKLIEVVEIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFLAFYPQLGVLNVMQL
FT                   ESPQSAILSAIIFNALIIIALIPLSLKGVAYRAVGAGALLRRNLLIYGLGGIVIPFAGI
FT                   KAIDLAITALHLV"
     MSAVKTTRRT TGSAMLDPAI VIPAIGSAFV KLDPRAMIKN PVMFVVEVVA ALTTAIFIKS        60
     IVTDGGGDGF GFTLQIILWL WFTVLFANFA EAVAEGRGKA QADTLRQTMT NTKAKKLLME       120
     GNYELYEGVP AENLEQGDLV LVEAGDLIPS DGEIIHGVAS VNEAAITGES APVIRESGGD       180
     RSAVTGGTMV ISDRIVVRIT AAKGNSFLDR MIKLVEGAAR QKTPNEIALN ILLAGLTIIF       240
     VFATVTIPSY AAYAGGQISV VVLAALFVTL IPTTIGALLS AIGIAGMDRL VRFNVLAMSG       300
     RAVEAAGDVD TLLLDKTGTI TLGNRQATAF RPVTGVSEEA LADAAQLASL ADETPEGRSI       360
     VVLAKEKYGL RGRDLAELSA TFVPFTAQTR MSGVDAGHSS VRKGAVDAIL NYVNGGGSRA       420
     VASGNAVRAL HPGMSDAARE ISAIADEVAK AGGTPLAVAK DGRLLGVVHL KDIVKGGIRE       480
     RFAELRRMGI RTVMITGDNP MTAAAIAAEA GVDDFLAQAT PEDKLKLIRD EQAKGKLVAM       540
     CGDGTNDAPA LAQADVGVAM NTGTQAAREA GNMVDLDSNP TKLIEVVEIG KQLLMTRGAL       600
     TTFSIANDVA KYFAIIPAMF LAFYPQLGVL NVMQLESPQS AILSAIIFNA LIIIALIPLS       660
     LKGVAYRAVG AGALLRRNLL IYGLGGIVIP FAGIKAIDLA ITALHLV                     707
//

If you have problems or comments...

PBIL Back to PBIL home page