(data stored in ACNUC7421 zone)

EMBL: CP000283.PE662

CP000283.PE662       Location/Qualifiers
FT   CDS             748667..749272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0664"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37902"
FT                   /db_xref="GOA:Q13DD7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DD7"
FT                   /protein_id="ABE37902.1"
FT                   /translation="MLKEIRPALVVLVVLTVICGLAYPLAMTGIAGVLFPEQAAGSLIV
FT                   KDGAVIGSALIGQEFKDDKYFHGRPSATSAADPADPTKTVSSPYNAANSSGSNLGPTSK
FT                   ALNDRVKEDVDKLKAENPSAAVPVDLVTASGSGLDPEISPEAALFQVPRVARARGLSED
FT                   GVRKLVNAQTKGRFAGLLGEPRVNVLALNLALDATTRK"
     MLKEIRPALV VLVVLTVICG LAYPLAMTGI AGVLFPEQAA GSLIVKDGAV IGSALIGQEF        60
     KDDKYFHGRP SATSAADPAD PTKTVSSPYN AANSSGSNLG PTSKALNDRV KEDVDKLKAE       120
     NPSAAVPVDL VTASGSGLDP EISPEAALFQ VPRVARARGL SEDGVRKLVN AQTKGRFAGL       180
     LGEPRVNVLA LNLALDATTR K                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page